PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_025398
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 504aa    MW: 55376.5 Da    PI: 7.64
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_025398genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.21.2e-31230286259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   DgynWrKYGqK+vk se+prsYY+Ct+a+Cpvkkkve+s  +++v+eitY+g+Hnhe
  DCAR_025398 230 ADGYNWRKYGQKQVKASEYPRSYYKCTYANCPVKKKVECSP-NGQVTEITYKGQHNHE 286
                  5****************************************.***************7 PP

2WRKY103.61.1e-32396454159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDg++WrKYGqK+vkg+++prsYY+Ct+agC+v+k+ver+++dpk+v++ Yeg+Hnh+
  DCAR_025398 396 LDDGFKWRKYGQKVVKGNQNPRSYYKCTYAGCNVRKHVERASTDPKAVITSYEGKHNHD 454
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.6E-28217288IPR003657WRKY domain
SuperFamilySSF1182901.83E-24226288IPR003657WRKY domain
SMARTSM007745.3E-33229287IPR003657WRKY domain
PROSITE profilePS5081122.366231288IPR003657WRKY domain
PfamPF031063.7E-24231286IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.8E-35381456IPR003657WRKY domain
SuperFamilySSF1182903.79E-28388456IPR003657WRKY domain
PROSITE profilePS5081136.162391456IPR003657WRKY domain
SMARTSM007741.9E-37396455IPR003657WRKY domain
PfamPF031063.8E-25397454IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MGEAEEALAT QARPSFTLNL PPRPSMEALF SGGPGLSPGP MTLVSNFFNE YYPDSDNCSF  60
SQLLAGAMAS PVAKTSQLSG KDMKSEDGSD KKSGFKQNRP MNLVVAQSPL FMMPPGLSPS  120
GFLNSPGFFS PLQSPFGMSH QQALAHVTAQ AALSQSQSFK HIQADSQLPS LLPASAETVT  180
HPSSSSELFF TQQMHDAKLE PENSKIDSPD ISNFERKSVS TSLCTDKPGA DGYNWRKYGQ  240
KQVKASEYPR SYYKCTYANC PVKKKVECSP NGQVTEITYK GQHNHELPLS NKRTKGGSDR  300
SRAVNAEAKV EPAFIGQTES SRSEETVPYH AVPTDQLSTQ LVPQQSHELT NDEEGYDAEP  360
RVNENIEVGT QELPISHRAV TESRIVVQTR SEVDLLDDGF KWRKYGQKVV KGNQNPRSYY  420
KCTYAGCNVR KHVERASTDP KAVITSYEGK HNHDTPTSRN SSHNSNNANA NQSRPARVGT  480
TKKPVHNDMD FETSQSPFLL QLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-36231456877Probable WRKY transcription factor 4
2lex_A3e-36231456877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661104.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9XI901e-126WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLF6H5W30.0F6H5W3_VITVI; Putative uncharacterized protein
STRINGVIT_14s0108g01280.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43142344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-120WRKY DNA-binding protein 4